PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000286526
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 358aa    MW: 39606.6 Da    PI: 6.6725
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000286526genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.5e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEd +l d++ + G g+W++ ++  g++R++k+c++rw +yl
    MDP0000286526 15 KGPWTTEEDAKLMDYISRNGHGSWRALPKLAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding53.17.6e-1768111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++++eE+  +++++  lG++ W++Ia +++ gRt++++k++w++
    MDP0000286526  68 RGKFSEEEERVIINLHSVLGNK-WSKIATHLP-GRTDNEIKNYWNT 111
                      89********************.*********.***********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.7511062IPR017930Myb domain
SuperFamilySSF466899.36E-3112109IPR009057Homeodomain-like
SMARTSM007172.9E-121464IPR001005SANT/Myb domain
PfamPF002492.7E-151562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-231669IPR009057Homeodomain-like
CDDcd001673.30E-91762No hitNo description
PROSITE profilePS5129428.37963117IPR017930Myb domain
SMARTSM007171.0E-1567115IPR001005SANT/Myb domain
PfamPF002492.2E-1568112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2670117IPR009057Homeodomain-like
CDDcd001674.42E-1270111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MVRAPCCDEE SSLKKGPWTT EEDAKLMDYI SRNGHGSWRA LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGK FSEEEERVII NLHSVLGNKW SKIATHLPGR TDNEIKNYWN TQLRKKLLHM  120
GIDPNTHRPR TDLNQLLDLS RLLSVALVGN SNKMTSPWDN ALKLKAAAGA AELTKMQLLQ  180
HLYMMPVVRT SNSSVPPNNY NVDLMNPSSS LFGSHILNPF GGGHVSGAST MLSGQEWNQQ  240
ADIVDGFHAI SNSLEGFEGG FGAQGVISSN SPDQENMSSS CCYDDIYVQT KNHPLPALVS  300
SSSVYPGTSP SAANQMEISM SGPAAPARTA IFDAWEKLMD DETSESYWKD ILEYVLAD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-31131175108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008373703.10.0PREDICTED: transcription factor MYB39-like
TrEMBLM5WRB41e-130M5WRB4_PRUPE; Uncharacterized protein
STRINGPOPTR_0003s09300.11e-111(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.22e-77myb domain protein 9